PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0003200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 271aa    MW: 30194.1 Da    PI: 7.8762
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0003200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.38.2e-285099251
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+ly ++s
  ORGLA02G0003200.1 50 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYQFAS 99
                       8***********************************************86 PP

2K-box74.14e-25123214899
              K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        + ee+  ++++ e++ L k+ie ++  + +llGe+L+s+s++eLq+Le qLeksl +iR+kK+++l++qi el++ke +l +en+ Lr + +
  ORGLA02G0003200.1 123 EGEESCVQKWRSEATTLGKKIEAIEGYKSKLLGEGLGSCSVQELQELEVQLEKSLCSIRQKKQKMLMDQILELREKEMNLLKENMVLRDQCK 214
                        3678889*********************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002653.77E-3432118No hitNo description
SMARTSM004321.8E-3541100IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.71641101IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-2943120IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004397IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-284363IPR002100Transcription factor, MADS-box
PfamPF003194.3E-265097IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-286378IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-287899IPR002100Transcription factor, MADS-box
PfamPF014865.9E-25126213IPR002487Transcription factor, K-box
PROSITE profilePS5129713.808129219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MAAAAAGVGG GGGVQQQETT TTVVQVAAEA SRKKVEVRSA GRRGRREMRR IEDATSRQVT  60
FSKRRSGLLK KAFELSVLCD AEVALIVFSP RGRLYQFASA SSDLQRTIDR YLNHTKNSSA  120
HEEGEESCVQ KWRSEATTLG KKIEAIEGYK SKLLGEGLGS CSVQELQELE VQLEKSLCSI  180
RQKKQKMLMD QILELREKEM NLLKENMVLR DQCKALSSPW STSVGELKNK QADDDVHRHE  240
DYSGGGVRDD DDRRMMEDVE TDLVIGRPGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A1e-1843122276Myocyte-specific enhancer factor 2B
1n6j_B1e-1843122276Myocyte-specific enhancer factor 2B
1tqe_P1e-1843122377Myocyte-specific enhancer factor 2B
1tqe_Q1e-1843122377Myocyte-specific enhancer factor 2B
1tqe_R1e-1843122377Myocyte-specific enhancer factor 2B
1tqe_S1e-1843122377Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040491e-167AP004049.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1212_C06.
GenBankAP0067201e-167AP006720.1 Oryza sativa Japonica Group genomic DNA, chromosome 2, clone:OJA1212_C06.
GenBankAP0149581e-167AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625202.10.0PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotQ9XJ601e-69MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLI1NWC60.0I1NWC6_ORYGL; Uncharacterized protein
STRINGORGLA02G0003200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-50AGAMOUS-like 20